RYR2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0298
Zusätzliche Namen:: ARVC2|ARVD2|RyR|RYR-2|RYR2|VACRDS|VTSIP
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 565 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Uniprot:: Q92736
Synonyme:: ARVC2;ARVD2;Cardiac muscle ryanodine receptor;cardiac muscle ryanodine receptor-calcium release channel;cardiac-type ryanodine receptor;islet-type ryanodine receptor;kidney-type ryanodine receptor;ryanodine receptor 2;ryanodine receptor 2 (cardiac);RyR;RYR-2;type 2 ryanodine receptor;VACRDS;VTSIP
Weitere Details:: This gene encodes a ryanodine receptor found in cardiac muscle sarcoplasmic reticulum. The encoded protein is one of the components of a calcium channel, composed of a tetramer of the ryanodine receptor proteins and a tetramer of FK506 binding protein 1B proteins, that supplies calcium to cardiac muscle. Mutations in this gene are associated with stress-induced polymorphic ventricular tachycardia and arrhythmogenic right ventricular dysplasia.