A0293
CARD8 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0293
- Zusätzliche Namen:
- CARD8|CARDINAL|DACAR|DAKAR|NDPP|NDPP1|TUCAN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFFQAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSEEQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRYSVWFPTAGWYLWSATGLGFL
- Uniprot:
- Q9Y2G2
- Synonyme:
- apoptotic protein NDPP1;CARD inhibitor of NF-kappaB-activating ligands;CARD-inhibitor of NF-kappa-B-activating ligand;CARDINAL;caspase recruitment domain-containing protein 8;DACAR;DAKAR;NDPP;NDPP1;TUCAN;tumor up-regulated CARD-containing antagonist of CASP9;tumor up-regulated CARD-containing antagonist of caspase nine
- Weitere Details:
- The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.
- Versandbedingungen:
- Blue Ice

