CARD8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0293
Zusätzliche Namen:: CARD8|CARDINAL|DACAR|DAKAR|NDPP|NDPP1|TUCAN
Anwendung:: ELISA, WB
Molekulargewicht:: 60 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFFQAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSEEQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRYSVWFPTAGWYLWSATGLGFL
Uniprot:: Q9Y2G2
Synonyme:: apoptotic protein NDPP1;CARD inhibitor of NF-kappaB-activating ligands;CARD-inhibitor of NF-kappa-B-activating ligand;CARDINAL;caspase recruitment domain-containing protein 8;DACAR;DAKAR;NDPP;NDPP1;TUCAN;tumor up-regulated CARD-containing antagonist of CASP9;tumor up-regulated CARD-containing antagonist of caspase nine
Weitere Details:: The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.

Versandbedingungen:: Blue Ice