A0289
MMP9 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0289
- Zusätzliche Namen:
- CLG4B|GELB|MANDP2|MMP-9|MMP9
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 96 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
- Uniprot:
- P14780
- Synonyme:
- 92 kDa gelatinase;92 kDa type IV collagenase;CLG4B;Gelatinase B;GELB;macrophage gelatinase;MANDP2;matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);matrix metalloproteinase-9;MMP-9;type V collagenase
- Weitere Details:
- Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
- Versandbedingungen:
- Blue Ice








