A0269
POLR1C Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0269
- Zusätzliche Namen:
- AC40|HLD11|POLR1C|RPA39|RPA40|RPA5|RPAC1|RPC40|TCS3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 39kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIA
- Uniprot:
- O15160
- Synonyme:
- AC40;DNA-directed RNA polymerase I subunit C;DNA-directed RNA polymerases I and III 40 kDa polypeptide;DNA-directed RNA polymerases I and III subunit RPAC1;HLD11;polymerase (RNA) I polypeptide C, 30kDa;polymerase (RNA) I subunit C;RNA polymerase I subunit C;RNA polymerases I and III subunit AC1;RPA39;RPA40;RPA5;RPAC1;RPC40;TCS3
- Weitere Details:
- The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

