MDK Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0251
Zusätzliche Namen:: ARAP|MDK|MK|NEGF2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Uniprot:: P21741
Synonyme:: amphiregulin-associated protein;ARAP;midgestation and kidney protein;midkine;MK;NEGF2;neurite growth-promoting factor 2;neurite outgrowth-promoting factor 2;Neurite outgrowth-promoting protein;retinoic acid inducible factor
Weitere Details:: This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed.