Cytokeratin 19 (KRT19) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0247
Zusätzliche Namen:: CK19|Cytokeratin 19 (KRT19)|K19|K1CS
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 40 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ELAYLKKNHEEEISTLRGQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQA
Uniprot:: P08727
Synonyme:: 40-kDa keratin intermediate filament;CK-19;CK19;cytokeratin 19;Cytokeratin-19;K19;K1CS;keratin 19, type I;Keratin-19;keratin, type I cytoskeletal 19;keratin, type I, 40-kd
Weitere Details:: The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21.

Versandbedingungen:: Blue Ice