A0246
c-Jun Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0246
- Zusätzliche Namen:
- AP-1|AP1|c-Jun|cJUN|p39
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 46kDa/42kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQ
- Uniprot:
- P05412
- Synonyme:
- activator protein 1;AP-1;AP1;c-Jun;cJUN;enhancer-binding protein AP1;Jun activation domain binding protein;jun oncogene;p39;proto-oncogene c-Jun;proto-oncogene cJun;transcription factor AP-1;v-jun avian sarcoma virus 17 oncogene homolog;v-jun sarcoma virus 17 oncogene homolog
- Weitere Details:
- This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.
- Versandbedingungen:
- Blue Ice



