IKKE Epsilon Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0244
Zusätzliche Namen:: IKK-E|IKK-i|IKKE|IKKI|IKKE Epsilon
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
Uniprot:: Q14164
Synonyme:: I-kappa-B kinase epsilon;IKK-E;IKK-epsilon;IKK-i;IKK-related kinase epsilon;IKKE;IKKI;inducible I kappa-B kinase;inducible IkappaB kinase;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon;inhibitor of nuclear factor kappa-B kinase subunit epsilon
Weitere Details:: IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).