c-Fos Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0236
Zusätzliche Namen:: AP-1|C-FOS|p55
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 55-60 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKT
Uniprot:: P01100
Synonyme:: activator protein 1;AP-1;C-FOS;cellular oncogene c-fos;Cellular oncogene fos;FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS);FBJ murine osteosarcoma viral oncogene homolog;Fos proto-oncogene, AP-1 trancription factor subunit;G0/G1 switch regulatory protein 7;p55;proto-oncogene c-Fos
Weitere Details:: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.