A0234
FasLG Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A0234
- Zusätzliche Namen:
- ALPS1B|APT1LG1|APTL|CD178|CD95-L|CD95L|FASL|FasLG|TNFSF6|TNLG1A
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 41kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
- Uniprot:
- P48023
- Synonyme:
- ALPS1B;apoptosis (APO-1) antigen ligand 1;apoptosis antigen ligand;APT1LG1;APTL;CD178;CD95 ligand;CD95-L;CD95L;fas antigen ligand;Fas ligand (TNF superfamily, member 6);FASL;mutant tumor necrosis factor family member 6;TNFSF6;TNLG1A;tumor necrosis factor ligand 1A;tumor necrosis factor ligand superfamily member 6
- Weitere Details:
- This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described.
- Versandbedingungen:
- Blue Ice