[KD Validated] ERK1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A0228
Zusätzliche Namen:: ERK-1|ERK1|ERT2|HS44KDAP|HUMKER1A|K1|p44-ERK1|p44-MAPK|P44ERK1|P44MAPK|PRKM3
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV
Uniprot:: P27361
Synonyme:: ERK-1;ERK1;ERT2;extracellular signal-regulated kinase 1;extracellular signal-related kinase 1;HS44KDAP;HUMKER1A;insulin-stimulated MAP2 kinase;MAP kinase isoform p44;MAPK 1;microtubule-associated protein 2 kinase;mitogen-activated protein kinase 3;p44-ERK1;p44-MAPK;P44ERK1;P44MAPK;PRKM3
Weitere Details:: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.

Versandbedingungen:: Blue Ice