A0227
p38 MAPK Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0227
- Zusätzliche Namen:
- CSBP|CSBP1|CSBP2|CSPB1|EXIP|Mxi2|p38|p38 MAPK|p38ALPHA|PRKM14|PRKM15|RK|SAPK2A
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
- Uniprot:
- Q16539
- Synonyme:
- CSAID-binding protein;CSBP;CSBP1;CSBP2;CSPB1;cytokine suppressive anti-inflammatory drug binding protein;Cytokine suppressive anti-inflammatory drug-binding protein;EXIP;MAP kinase 14;MAP kinase Mxi2;MAP kinase p38 alpha;MAX-interacting protein 2;mitogen-activated protein kinase 14;mitogen-activated protein kinase p38 alpha;Mxi2;p38;p38 MAP kinase;p38 mitogen activated protein kinase;p38ALPHA;p38alpha Exip;PRKM14;PRKM15;RK;SAPK2A;stress-activated protein kinase 2A
- Weitere Details:
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
- Versandbedingungen:
- Blue Ice





_WB_01.jpg)
_WB_01.jpg)
_WB_01.jpg)
_WB_01.jpg)