A0213
BVES Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0213
- Zusätzliche Namen:
- BVES|CARICK|HBVES|LGMD2X|LGMDR25|POP1|POPDC1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP
- Uniprot:
- Q8NE79
- Synonyme:
- blood vessel epicardial substance;CARICK;HBVES;LGMD2X;LGMDR25;POP1;POPDC1;popeye domain-containing protein 1
- Weitere Details:
- This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in development of these tissues. The mouse ortholog may be involved in the regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Three transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice

