A0211
Bmi1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A0211
- Zusätzliche Namen:
- Bmi1|flvi-2/bmi-1|FLVI2/BMI1|PCGF4|RNF51
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
- Uniprot:
- P35226
- Synonyme:
- B lymphoma Mo-MLV insertion region 1 homolog;BMI1;BMI1 polycomb ring finger oncogene;BMI1 polycomb ring finger proto-oncogene;COMMD3-BMI1 read-through protein;flvi-2/bmi-1;FLVI2/BMI1;murine leukemia viral (bmi-1) oncogene homolog;PCGF4;polycomb complex protein BMI-1;polycomb group protein Bmi1;polycomb group RING finger protein 4;ring finger protein 51;RNF51
- Weitere Details:
- This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.
- Versandbedingungen:
- Blue Ice