CaMKII Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0198
Zusätzliche Namen:: CAM2|CAMK2|CAMKB|CaMKII|CaMKIIbeta|MRD54
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 50kDa/60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
Uniprot:: Q13554
Synonyme:: calcium/calmodulin-dependent protein kinase type II subunit beta;CaM kinase II beta subunit;CaM-kinase II beta chain;CAM2;caMK-II subunit beta;CAMK2;CAMKB;CaMKIIbeta;MRD54;proline rich calmodulin-dependent protein kinase
Weitere Details:: The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.