CaMK2 delta/CAMK2 gamma Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0186
Zusätzliche Namen:: CAM2|CAMK2|CaMK2 delta/CAMK2 gamma|CAMKB|CaMKIIbeta|MRD54
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 60 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
Uniprot:: Q13555, Q13557
Synonyme:: calcium/calmodulin-dependent protein kinase (CaM kinase) II delta;calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma;calcium/calmodulin-dependent protein kinase type II delta chain;calcium/calmodulin-dependent protein kinase type II subunit delta;calcium/calmodulin-dependent protein kinase type II subunit gamma;CaM kinase II delta subunit;CaM-kinase II delta chain;CAMK;CAMK-II;CaMK-II delta subunit;caMK-II subunit gamma;CAMKD;CAMKG;MRD59
Weitere Details:: The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice