GDF15 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A0185
Zusätzliche Namen:: GDF-15|GDF15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Uniprot:: Q99988
Synonyme:: GDF-15;growth/differentiation factor 15;macrophage inhibitory cytokine 1;MIC-1;MIC1;NAG-1;non-steroidal anti-inflammatory drug-activated gene-1;NRG-1;NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1;NSAID-activated gene 1 protein;NSAID-regulated gene 1 protein;PDF;PLAB;placental bone morphogenetic protein;placental TGF-beta;prostate differentiation factor;PTGF-beta;PTGFB
Weitere Details:: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.

Versandbedingungen:: Blue Ice