A0165
Hexokinase II Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A0165
- Zusätzliche Namen:
- HKII|HXK2|II
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 115kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
- Uniprot:
- P52789
- Synonyme:
- hexokinase type II;hexokinase-2;hexokinase-2, muscle;hexokinase-B;HKII;HXK2;muscle form hexokinase
- Weitere Details:
- Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.
- Versandbedingungen:
- Blue Ice



