A0121
CCR7 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A0121
- Zusätzliche Namen:
- BLR2|CC-CKR-7|CCR-7|CCR7|CD197|CDw197|CMKBR7|EBI1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL
- Uniprot:
- P32248
- Synonyme:
- BLR2;Bukitt's lymphoma receptor 2;C-C chemokine receptor type 7;CC chemokine receptor 7;CC-CKR-7;CCR-7;CD197;CDw197;chemokine (C-C motif) receptor 7;CMKBR7;EBI1;EBV-induced G protein-coupled receptor 1;Epstein-Barr virus induced gene 1;Epstein-Barr virus-induced G-protein coupled receptor 1;lymphocyte-specific G protein-coupled peptide receptor;MIP-3 beta receptor
- Weitere Details:
- The protein encoded by this gene is a member of the G protein-coupled receptor family.This receptor was identified as a gene induced by the Epstein-Barr virus (EBV),and is thought to be a mediator of EBV effects on B lymphocytes.This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes.It has been shown to control the migration of memory T cells to inflamed tissues,as well as stimulate dendritic cell maturation.The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor.Signals mediated by this receptor regulate T cell homeostasis in lymph nodes,and may also function in the activation and polarization of T cells,and in chronic inflammation pathogenesis.Alternative splicing of this gene results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice