A0040
MET Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A0040
- Zusätzliche Namen:
- AUTS9|c-Met|DA11|DFNB97|HGFR|MET|RCCP2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 140kDa/170kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMK
- Uniprot:
- P08581
- Synonyme:
- AUTS9;c-Met;DFNB97;hepatocyte growth factor receptor;HGF receptor;HGF/SF receptor;HGFR;proto-oncogene c-Met;RCCP2;scatter factor receptor;SF receptor;tyrosine-protein kinase Met
- Weitere Details:
- This gene encodes a member of the receptor tyrosine kinase family of proteins and the product of the proto-oncogene MET. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that are linked via disulfide bonds to form the mature receptor. Further processing of the beta subunit results in the formation of the M10 peptide, which has been shown to reduce lung fibrosis. Binding of its ligand, hepatocyte growth factor, induces dimerization and activation of the receptor, which plays a role in cellular survival, embryogenesis, and cellular migration and invasion. Mutations in this gene are associated with papillary renal cell carcinoma, hepatocellular carcinoma, and various head and neck cancers. Amplification and overexpression of this gene are also associated with multiple human cancers.
- Versandbedingungen:
- Blue Ice

