Cytokeratin 4 (KRT4) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A0013
Zusätzliche Namen:: CK-4|CK4|CYK4|Cytokeratin 4 (KRT4)|K4|WSN1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPG
Uniprot:: P19013
Synonyme:: CK-4;CK4;CYK4;cytokeratin 4;Cytokeratin-4;K4;keratin 4, type II;Keratin-4;keratin, type II cytoskeletal 4;type-II keratin Kb4;WSN1
Weitere Details:: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.