Skip to content

Warenkorb

Der Warenkorb ist leer.

Gesamt (exkl. MwSt.) £0,00
Warenkorb überprüfen & bezahlen
Proteine und Peptide

Amyloid Beta Peptide 1-40 Monomers

Produktgrößen
100 ug
£484,00
SPR-530-100UG
2 x 100 ug
£812,00
SPR-530-2X100UG
5 x 100 ug
£1615,00
SPR-530-5X100UG
Über dieses Produkt
SKU:
SPR-530
Zusätzliche Namen:
AB Beta 1-40, AB40, Amyloid beta 1-40, Beta-amyloid peptide (1-40), Amyloid-beta A4 protein, Amyloid precursor protein (APP), Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide (CVAP), Protease nexin-II (PN-II), PreA4, Peptidase nexin-II, APP40, BAPP40, BetaAPP40
Anwendung:
SDS-PAGE, Western Blot
Buffer:
PB pH7.4, 10mM NaCl
CE/IVD:
Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Konzentration:
1 mg/ml
Weitere Details:
Amyloid Beta Peptide 1-40 (AB Beta40) is one of the primary proteolytic products of the amyloid precursor protein (APP), generated through sequential B Beta- and G Gamma-secretase cleavage. As a major soluble isoform of amyloid beta, AB Beta40 is produced at higher levels than AB Beta42 and plays a central role in Alzheimer's disease (AD) pathology. Although less aggregation-prone than AB Beta42, AB Beta40 contributes significantly to neurodegenerative processes by participating in early oligomer formation, interacting with neuronal membranes, and influencing metal-dependent oxidative stress pathways that can impair synaptic function and cellular viability. The AB Beta42:AB Beta40 ratio is an important modulator of aggregation behavior, with AB Beta40 capable of altering fibrillation kinetics and influencing toxicity profiles across neuronal and glial populations. AB Beta40 is also a major component of cerebral amyloid angiopathy and affects vascular integrity, endothelial function, and neurovascular signaling. Its interactions with glial cells can shape inflammatory responses and modify plaque architecture, thereby impacting disease progression. Synthetic AB Beta40 monomers, such as those produced by StressMarq, provide researchers with a consistent and biologically relevant tool for experimental modeling. These monomers appear as a single band at the expected molecular weight on SDS-PAGE and Western blot, supporting reproducibility in assays investigating aggregation mechanisms, membrane interactions, oxidative stress responses, and therapeutic modulation. By enabling precise control over peptide concentration, purity, and structural state, AB Beta40 monomers serve as foundational reagents in AD research-facilitating studies on early pathogenic events, biomarker development, and the evaluation of candidate therapeutics designed to disrupt amyloidogenic pathways. StressMarq's Amyloid Beta Peptide 1-40 Monomers are produced synthetically and presents as a monomeric band at the expected molecular weight (MW) on SDS-PAGE via Coomassie Stain and Western Blot.
Immunogen:
Amyloid Beta Peptide 1-40 Monomers
Molekulargewicht:
4.5 kDa
Reinheit:
>98%
Sequenz:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Versandbedingungen:
Dry Ice
Lagerbedingungen:
-70[o]C
Hersteller:
StressMarq Biosciences
Typ:
Proteins, Peptides, Small Molecules & Other Biomolecules: Synthetic