Alpha Synuclein Pre-formed Fibrils: Biotinylated
Produktgrößen
100 ug
£556,00
SPR-528-100UG
2 x 100 ug
£941,00
SPR-528-2X100UG
5 x 100 ug
£1884,00
SPR-528-5X100UG
Über dieses Produkt
- SKU:
- SPR-528
- Zusätzliche Namen:
- Alpha-synuclein, A Alpha-synuclein, SNCA, Synelfin, NACP, Non-AB Beta component of Alzheimer's disease amyloid protein, Non-A beta component precursor, NACP140, PARK1 protein, PARK4 protein, Synuclein alpha, ASYN, Alpha-syn, Macaca fascicularis, UniProt: A0A2K5XN14
- Anwendung:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- PBS
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Konjugat:
- Biotin
- Konzentration:
- 2 mg/ml
- Weitere Details:
- Alpha-synuclein is a 140-amino-acid neuronal protein encoded by the SNCA gene and is highly enriched at presynaptic terminals, where it regulates synaptic vesicle trafficking, neurotransmitter release, and membrane interactions. In neurodegenerative disorders such as Parkinson's disease, dementia with Lewy bodies, and multiple system atrophy, misfolded alpha-synuclein adopts aggregation-prone conformations that progress from soluble monomers to toxic oligomers and fibrils, ultimately forming Lewy body pathology and driving cellular dysfunction and neurodegeneration. Biotinylated alpha-synuclein pre-formed fibrils (PFFs) are powerful molecular tools that enable precise tracking, quantification, and manipulation of pathogenic fibrillar species. Because PFFs replicate the structural and biochemical characteristics of disease-associated fibrils-including amyloid-like B Beta-sheet conformation and seeding capacity-they provide a controlled system for inducing endogenous alpha-synuclein aggregation in cellular and in vivo models. When biotinylated, these fibrils can be selectively captured, imaged, or enriched, allowing researchers to dissect early aggregation events, map protein interactomes, and monitor fibril propagation with exceptional sensitivity. Biotinylated PFFs also support mechanistic studies on prion-like spread, synaptic dysfunction, mitochondrial impairment, and neuroinflammatory signaling, all of which are central to synucleinopathy progression. By enabling reproducible seeding assays and high-resolution interrogation of fibril-cell interactions, they accelerate therapeutic discovery efforts targeting fibril formation, uptake, clearance, and downstream pathological cascades. As a result, biotinylated alpha-synuclein PFFs have become essential reagents for advancing translational neurodegeneration research and for developing next-generation strategies to halt or reverse protein-misfolding diseases. A 15 amino acid tag on the C-terminal tail of alpha synuclein facilitates site-specific covalent biotinylation. Biotinylation of purified alpha synuclein allows for many biological applications, such as monitoring and detection using streptavidin-based conjugates. Stressmarq's pre-formed fibrils are generated from biotinylated alpha synuclein monomers.
- Immunogen:
- Alpha Synuclein PFFs (Cynomolgus)
- Molekulargewicht:
- 16.28 kDa
- Reinheit:
- >95%
- Aufreinigung:
- Ion Exchange
- Sequenz:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQKIEWHE
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C
- Hersteller:
- StressMarq Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:https://www.stressmarq.com/products/protein/alpha-synuclein-pre-formed-fibrils:-biotinylated-spr-528/