Alpha Synuclein E114C Mutant Pre-formed Fibrils: ATTO 488
Produktgrößen
500 ug
£1884,00
SPR-518XE-A488-500UG
Über dieses Produkt
- SKU:
- SPR-518XE-A488
- Zusätzliche Namen:
- Alpha Synuclein E114C, Alpha-synuclein, Alpha synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP, SNCA, PARK1, SYN, PD1, PARK4, Synuclein Alpha, Asyn, Alpha Synuclein PFFs, ATTO labelled Alpha Synuclein fibrils
- Anwendung:
- Cell-based/Functional Assay, Western Blot
- Buffer:
- 1X PBS pH 7.4
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Konjugat:
- ATTO 488
- Weitere Details:
- Alpha-synuclein (A Alpha-synuclein), encoded by the SNCA gene, is a neuronal protein central to synaptic vesicle regulation and neurotransmitter release. Its misfolding and aggregation are key pathological features of Parkinson's disease and other synucleinopathies. The E114C mutation introduces a cysteine residue at position 114, enabling site-specific chemical labeling without significantly altering the protein's native structure. This engineered variant retains the functional domains of wild-type A Alpha-synuclein, making it a versatile tool for probing molecular mechanisms of aggregation and toxicity. The alpha-synuclein (aSyn) E114C mutation facilitates a single site-specific conjugation with ATTO-488 maleimide that avoids any hindrance on fibrilization or cell entry that may be conferred by non-specific lysine targeting conjugations. This conjugation is ideal due to internal position relative to C-terminal truncation sites, proximity to the NAC, and lack of interference with recruitment in vitro or in primary neurons (1, 2). Pre-formed fibrils (PFFs) generated with 5-25% fluorescently tagged E114C mutants have demonstrated a relative potency >80% compared to wild-type aSyn for inducing misfolding of endogenous aSyn, indicating no significant perturbation of seeding in living cells (1). ATTO-488 is a useful tool for identifying cell entry, as the addition of Trypan Blue to cultures prior to imaging will quench fluorescence of extracellular ATTO-488 conjugated aSyn (3). StressMarq's aSyn E114C-ATTO-488 PFFs, which are formed from 10% fluorescently tagged E114C mutants and 90% wild-type monomers, are an excellent tool for studying cell entry and localization, with demonstrated entry into neurons after trypan blue quenching.
- Immunogen:
- Alpha Synuclein E114C PFFs
- Molekulargewicht:
- 14.434 kDa
- Reinheit:
- >95%
- Aufreinigung:
- Ion-exchange & SEC purified
- Sequenz:
- 10% of mixture (mutant conjugated form): MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILCDMPVDPDNEAYEMPSEEGYQDYEPEA 90% of mixture (wildtype): MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C
- Hersteller:
- StressMarq Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein