Skip to content

Warenkorb

Der Warenkorb ist leer.

Gesamt (exkl. MwSt.) £0,00
Warenkorb überprüfen & bezahlen

Alpha Synuclein E114C Mutant Monomers: ATTO 488

Produktgrößen
100 ug
£622,00
SPR-517-A488-100UG
2 x 100 ug
£921,00
SPR-517-A488-2X100UG
500 ug
£1769,00
SPR-517-A488-500UG
Über dieses Produkt
SKU:
SPR-517-A488
Zusätzliche Namen:
Alpha Synuclein E114C, Alpha-synuclein, Alpha synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP, SNCA, PARK1, SYN, PD1, PARK4, Synuclein Alpha, Asyn, ATTO labelled Alpha Synuclein monomers
Anwendung:
Cell-based/Functional Assay, Western Blot
Buffer:
1X PBS pH 7.4
CE/IVD:
Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Konjugat:
ATTO 488
Weitere Details:
Alpha-synuclein (A Alpha-synuclein), encoded by the SNCA gene, is a presynaptic neuronal protein involved in synaptic vesicle trafficking, neurotransmitter release, and SNARE-complex assembly. Misfolding and aggregation of A Alpha-synuclein are central to the pathology of Parkinson's disease and other synucleinopathies. The E114C mutation introduces a cysteine residue at position 114, enabling site-specific labeling and cross-linking for advanced biochemical and biophysical studies. This engineered variant retains the core functional domains of wild-type A Alpha-synuclein while offering enhanced experimental versatility. E114C mutant monomers are particularly useful for probing conformational changes, oligomerization pathways, and membrane interactions under physiological and pathological conditions. In neurodegenerative disease research, E114C monomers facilitate high-resolution analysis of early aggregation events and protein-protein interactions. Their compatibility with thiol-reactive probes allows for precise tracking of A Alpha-synuclein dynamics in vitro and in vivo. These monomers are instrumental in identifying molecular triggers of misfolding, mapping interaction networks, and screening therapeutic compounds that stabilize native conformations or prevent toxic oligomer formation. By enabling targeted investigation of A Alpha-synuclein structure and behavior, E114C mutant monomers accelerate the development of disease-modifying therapies. Their application supports translational research aimed at understanding and mitigating the molecular mechanisms underlying Parkinson's disease and related neurodegenerative disorders. The alpha-synuclein (aSyn) E114C mutation facilitates a single site-specific conjugation with ATTO-488 maleimide that avoids any hindrance on fibrilization or cell entry that may be conferred by non-specific lysine targeting conjugations. This conjugation is ideal due to internal position relative to C-terminal truncation sites, proximity to the NAC, and lack of interference with recruitment in vitro or in primary neurons. Pre-formed fibrils (PFFs) generated with 5-25% fluorescently tagged E114C mutants have demonstrated a relative potency >80% compared to wild-type aSyn for inducing misfolding of endogenous aSyn, indicating no significant perturbation of seeding in living cells. ATTO-488 is a useful tool for identifying cell entry, as the addition of Trypan Blue to cultures prior to imaging will quench fluorescence of extracellular ATTO-488 conjugated aSyn.
Immunogen:
Alpha Synuclein E114C Monomers
Molekulargewicht:
14.434 kDa
Reinheit:
>95%
Aufreinigung:
Ion-exchange & SEC purified
Sequenz:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILCDMPVDPDNEAYEMPSEEGYQDYEPEA
Versandbedingungen:
Dry Ice
Lagerbedingungen:
-70[o]C
Hersteller:
StressMarq Biosciences
Typ:
Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein