Alpha Synuclein Monomers: Biotinylated (C-terminus)
Produktgrößen
500 ug
£1615,00
SPR-507XE-500UG
Über dieses Produkt
- SKU:
- SPR-507XE
- Zusätzliche Namen:
- Alpha-synuclein, Alpha synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP, SNCA, PARK1, SYN, PD1, PARK4, Synuclein Alpha, Parkinson's disease familial 1 Protein, Biotin Alpha Synuclein , Asyn
- Anwendung:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- PBS
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Konjugat:
- Biotin
- Weitere Details:
- Alpha-synuclein (A Alpha-synuclein), encoded by the SNCA gene, is a neuronal protein that plays a central role in synaptic vesicle trafficking, neurotransmitter release, and SNARE-complex assembly. Misfolding and aggregation of A Alpha-synuclein are key pathological features of Parkinson's disease and other synucleinopathies. Biotinylated A Alpha-synuclein monomers are chemically modified to include biotin tags, enabling precise detection, tracking, and immobilization in experimental systems. This modification does not significantly alter the protein's native structure or function, making biotinylated monomers a powerful tool for studying early aggregation events and protein-protein interactions. In neurodegenerative disease research, biotinylated A Alpha-synuclein monomers facilitate high-resolution analysis of aggregation kinetics, seeding behavior, and cellular uptake. Their compatibility with streptavidin-based assays allows for sensitive quantification and visualization of A Alpha-synuclein dynamics in vitro and in vivo. These monomers are particularly useful in identifying molecular triggers of misfolding, mapping interaction networks, and screening therapeutic compounds that inhibit aggregation or enhance clearance. By enabling targeted and reproducible investigation of A Alpha-synuclein biology, biotinylated monomers accelerate the development of disease-modifying therapies. Their application supports translational research aimed at understanding and mitigating the molecular mechanisms underlying Parkinson's disease and related neurodegenerative disorders. A 15 amino acid tag on the C-terminal tail of Alpha Synuclein facilitates site-specific covalent biotinylation (1). StressMarq's biotinylated monomers are also used to generate pre-formed fibrils in vitro.
- Immunogen:
- Alpha Synuclein Monomers
- Molekulargewicht:
- 16.27 kDa
- Reinheit:
- >95% based on SDS-PAGE and nanodrop analysis.
- Aufreinigung:
- Ion Exchange
- Sequenz:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQK IEWHE
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C
- Hersteller:
- StressMarq Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Datenblatt des Herstellers:https://www.stressmarq.com/products/protein/alpha-synuclein-monomers:-biotinylated-c-terminus-spr-507/