Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils
Produktgrößen
100 ug
£632,00
SPR-492-100UG
2 x 100 ug
£936,00
SPR-492-2X100UG
5 x 100 ug
£1776,00
SPR-492-5X100UG
Über dieses Produkt
- SKU:
- SPR-492
- Zusätzliche Namen:
- AB Beta 3-42, Amyloid beta 3-42, Beta amyloid peptide, Abeta, Abeta peptide, Amyloid beta precursor peptide, APP, pyro abeta, pyro amyloid beta, pyroglutamate amyloid beta, AB BetaPE3, Amyloid Beta PFFs
- Anwendung:
- Cell-based/Functional Assay, Western Blot
- Buffer:
- 10mM HCl with 2% DMSO
- CE/IVD:
- RUO
- Konzentration:
- 1 mg/ml
- Weitere Details:
- Amyloid beta (AB Beta) peptides, particularly the pyroglutamate-modified variant AB Beta 3-42, are increasingly recognized as key contributors to Alzheimer's disease. This truncated form arises from post-translational modification of AB Beta peptides, where the N-terminal glutamate is cyclized into pyroglutamate, enhancing hydrophobicity, resistance to degradation, and aggregation propensity. Pre-formed fibrils (PFFs) of AB Beta 3-42 replicate the B Beta-sheet-rich architecture of amyloid plaques found in Alzheimer's brains. These fibrils exhibit heightened neurotoxicity compared to full-length AB Beta 1-42, due to their increased stability and ability to seed further aggregation. AB Beta 3-42 PFFs are particularly effective at inducing synaptic dysfunction, neuroinflammation, and neuronal death, making them a powerful model for studying the molecular mechanisms of disease progression. In experimental systems, AB Beta 3-42 PFFs are used to investigate prion-like propagation, cellular uptake, and the impact on neuronal networks. Their relevance to human pathology supports their use in preclinical drug screening, enabling the evaluation of therapeutic agents targeting aggregation, clearance, and neuroprotection. By modeling a highly pathogenic form of AB Beta, pyroglutamate 3-42 PFFs provide a robust and translationally relevant platform for advancing Alzheimer's disease research and accelerating the development of effective interventions. StressMarq's Amyloid Beta Pyroglutamate 3-42 (pyro AB Beta) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). StressMarq's pyro AB Beta3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody.
- Immunogen:
- Amyloid Beta PFFs: Pyroglutamate
- Molekulargewicht:
- 4.3 kDa
- Reinheit:
- >95%
- Sequenz:
- pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C
- Hersteller:
- StressMarq Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Synthetic
- Datenblatt des Herstellers:https://www.stressmarq.com/products/protein/amyloid-beta-protein-spr-492/