HSP90 Protein
Produktgrößen
50 ug
£269,00
SPR-122-50UG
100 ug
£412,00
SPR-122-100UG
Über dieses Produkt
- SKU:
- SPR-122
- Zusätzliche Namen:
- HSP90, HSP90AB1, HSP90-beta, HSPCB, HSPC2, Heat shock protein HSP 90-beta, Heat shock 84 kDa protein, HSP84, HSP90B
- Anwendung:
- SDS-PAGE, Western Blot
- Buffer:
- 50mM Tris/HCl pH7.5, 300mM NaCl, 10% glycerol
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Weitere Details:
- HSP90 is a highly conserved and abundantly expressed molecular chaperone that exists in two major cytosolic isoforms: HSP90A Alpha and HSP90B Beta. It is essential for the folding, stabilization, and functional regulation of a wide array of client proteins, many of which are involved in signal transduction, cell cycle control, and stress responses. In the nervous system, HSP90 plays a critical role in maintaining proteostasis, particularly under conditions of cellular stress. It forms dynamic complexes with co-chaperones such as CDC37, p23, and immunophilins, which guide the maturation and stabilization of client proteins. This function is especially relevant in neurodegenerative diseases, where protein misfolding and aggregation are central pathological features. HSP90 has been shown to interact with key neurodegenerative disease-related proteins, including tau, A Alpha-synuclein, and huntingtin. While it can stabilize these proteins and prevent aggregation, it may also inadvertently preserve toxic conformers. As such, HSP90 is a double-edged sword in neurodegeneration-both protective and potentially pathogenic. Pharmacological inhibition of HSP90 has emerged as a therapeutic strategy to promote the degradation of misfolded proteins and restore cellular homeostasis. Its high expression in neurons and involvement in multiple neurodegenerative pathways make HSP90 a compelling target for therapeutic intervention and biomarker development.
- Immunogen:
- HSP90 Protein
- Molekulargewicht:
- ~21.4 kDa
- Reinheit:
- >90%
- Aufreinigung:
- Affinity Purified
- Sequenz:
- QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- StressMarq Biosciences
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:https://www.stressmarq.com/products/protein/hsp90-protein-spr-122/