Presenilin 2 loop region, Rabbit Polyclonal Antibody
Produktgrößen
500 ug
£402,00
R-1681-500UG
Über dieses Produkt
- SKU:
- R-1681
- Zusätzliche Namen:
- AD3LP, AD5, E5-1, STM-2
- Anwendung:
- Immunocytochemistry, Western Blot
- CE/IVD:
- RUO
- Klonalität:
- Polyclonal
- Weitere Details:
- Rabbit anti-Presenilin 2 loop region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
- Format:
- Lyophilized from PBS, pH 7.4. Contains no preservative.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
- Isotyp:
- IgG
- Aufreinigung:
- Protein G Purified
- Reaktivitäten:
- Human, Mouse
- Versandbedingungen:
- Ambient
- Spezifität:
- Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
- Lagerbedingungen:
- 2-8[o]C
- Hersteller:
- Biosensis
- Typ:
- Antibody: Polyclonal Antibody