Anti-Presenilin 2 loop region Antibody
Produktgrößen
500 ug
£384,00
R-1681-500-500UG
Über dieses Produkt
- SKU:
- R-1681-500
- Zusätzliche Namen:
- AD3LP, AD5, E5-1, STM-2
- Anwendung:
- Immunocytochemistry, Western Blot
- Buffer:
- Lyophilized from PBS
- CE/IVD:
- RUO
- Klonalität:
- Polyclonal
- Weitere Details:
- Our Anti-Presenilin 2 loop region rabbit polyclonal primary antibody detects human and mouse Presenilin 2 loop region, and is IgG. It is validated for use in ICC, WB., Biosensis
- Formulierung:
- Lyophilized from PBS, pH 7.4. Contains no preservative.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
- Isotyp:
- IgG
- Molekulargewicht:
- 22 kDa, 45 kDa (See application details.)
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Protein G purified IgG
- Reaktivitäten:
- Human, Mouse
- Versandbedingungen:
- Ambient
- Spezifität:
- Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
- Hersteller:
- Biosensis
- Typ:
- Antibody: Polyclonal Antibody