Anti-Agouti related protein (AGRP) Antibody
Produktgrößen
50 ul
£384,00
GP-029-50-50UL
Über dieses Produkt
- SKU:
- GP-029-50
- Zusätzliche Namen:
- Agrp; Agrt; Art; Agouti-related protein
- Anwendung:
- IHC-Frozen
- CE/IVD:
- RUO
- Klonalität:
- Polyclonal
- Weitere Details:
- Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen., Biosensis
- Host:
- Guinea Pig
- Immunogen:
- A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
- Isotyp:
- Mixed
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Neat Serum
- Reaktivitäten:
- Human, Mouse, Rat, Sheep
- Versandbedingungen:
- Ambient
- Spezifität:
- Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
- Hersteller:
- Biosensis
- Typ:
- Antibody: Polyclonal Antibody