CNTF
Produktgrößen
5 ug
£147,06
R20-001-5UG
25 ug
£270,59
R20-001-25UG
Über dieses Produkt
- SKU:
- R20-001
- Zusätzliche Namen:
- Cntf
- Buffer:
- 5 mM sodium acetate, pH 6.5
- translate.label.attr.clone:
- Rabbit IgG
- Weitere Details:
- Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The cDNA for CNTF encodes a 200 amino acid residue polypeptide that lacks a signal sequence. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF, and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes. The cDNA for recombinant rat CNTF (Ala2-Met200) was cloned from total RNA of a rat embryo using standard protocols. Ciliary Neurotrophic Factor (CNTF) is a potent neural factor that was originally characterized as a survivability factor for chick ciliary neurons in vitro. More recently, CNTF has been shown to promote survivability and differentiation of other neuronal cell types. Rat CNTF is a 22.7 kDa protein containing 199 amino acid residues.
- Formulierung:
- lyophilized
- Host:
- Rabbit
- Molekulargewicht:
- 22.7 K kDa
- Reinheit:
- >98%
- Reaktivitäten:
- Rat
- Sequenz:
- AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins