GM-CSF
Produktgrößen
50 ug
£411,76
M30-013-50UG
Über dieses Produkt
- SKU:
- M30-013
- Zusätzliche Namen:
- Csf2; Csfgm; GMCSF; Gm-CSf; MGI-IGM
- Buffer:
- 30 mM Tris pH8
- translate.label.attr.clone:
- (#5D34)
- Weitere Details:
- GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 124 amino acids residues.
- Formulierung:
- lyophilized
- Host:
- Mouse
- Molekulargewicht:
- 14.2 kDa
- Reinheit:
- >98%
- Reaktivitäten:
- Mouse
- Sequenz:
- MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins