BMP-4
Produktgrößen
2 ug
£179,00
M10-044-2UG
10 ug
£307,00
M10-044-10UG
Über dieses Produkt
- SKU:
- M10-044
- Zusätzliche Namen:
- Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1
- Buffer:
- 10mM Citric Acid
- Weitere Details:
- Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-B Beta superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. This E.coli derived murine BMP-4 is a fully active homodimeric protein consisting of two 106 amino acid subunits which correspond to amino acids 303-408 of the full length BMP-4 precursor.
- Formulierung:
- lyophilized
- Host:
- Mouse
- Molekulargewicht:
- 23.9 kDa
- Reinheit:
- >98% by SDS-PAGE & HPLC analysis
- Reaktivitäten:
- Mouse
- Sequenz:
- KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins