Lactogen, placental
Produktgrößen
10 ug
£277,65
500-035-10UG
50 ug
£404,71
500-035-50UG
Über dieses Produkt
- SKU:
- 500-035
- Zusätzliche Namen:
- Chorionic somatomammotropin hormone 1, Choriomammotropin, Placental lactogen (PL)
- Weitere Details:
- Recombinant human placental lactogen, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 22.4 kDa, was purified by proprietary chromatographic techniques.
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 22.4 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Human
- Sequenz:
- AVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins