IL-22, pegylated
Produktgrößen
10 ug
£411,76
500-026-10UG
50 ug
£1164,71
500-026-50UG
Über dieses Produkt
- SKU:
- 500-026
- Zusätzliche Namen:
- I-TIF
- translate.label.attr.clone:
- (#4G1G)
- Weitere Details:
- Mono-pegylated (with 20 kDa PEG)recombinant human interleukin 22 is one polypeptide chain containing 147 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 36 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 50 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. It was prepared similarly to that described by L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 36.0 kDa (monomer)
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Human
- Sequenz:
- AAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins