Growth Hormone
Produktgrößen
10 ug
£277,65
500-021-10UG
50 ug
£404,71
500-021-50UG
Über dieses Produkt
- SKU:
- 500-021
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- Recombinant rainbow trout growth hormone (rtGH) produced in E. coli (22 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21535 Dalton. rtGH is expressed as inclusion bodies, refolded and purified by proprietary chromatographic techniques.
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 22.0 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE.
- Sequenz:
- AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins