Growth Hormone Receptor (hGH binding protein), soluble
Produktgrößen
100 ug
£647,00
500-016-100UG
50 ug
£674,00
500-016-50UG
Über dieses Produkt
- SKU:
- 500-016
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- Recombinant rbGHBP, one polypeptide chain containing 248 amino acids and having a molecular mass of ~ 28 kDa, Rabbit GHBP was purified by proprietary chromatographic techniques, (see Sakal et al. Prep Biochem Biotechnol. 30:107-23, 2000).
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 28.0 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequenz:
- AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRF
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins