Growth Hormone
Produktgrößen
10 ug
£277,65
500-015-10UG
50 ug
£404,71
500-015-50UG
Über dieses Produkt
- SKU:
- 500-015
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- Recombinant rabbit growth hormone (rbGH), one polypeptide chain containing 190 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 21.5 kDa
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 21.5 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequenz:
- AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAFTNTLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCVF
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins