PDGF-AA
Produktgrößen
20 ug
£271,00
200-052-20UG
Über dieses Produkt
- SKU:
- 200-052
- Zusätzliche Namen:
- PDGFA; PDGF1; PDGF-A
- Buffer:
- 50mM acetic acid
- Weitere Details:
- PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AA is a 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids).
- Formulierung:
- lyophilized
- Host:
- Insect/Arthropod
- Molekulargewicht:
- 28.5 kda
- Reinheit:
- >95%
- Reaktivitäten:
- Human
- Sequenz:
- SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins