Angiopoietin-like protein 3
Produktgrößen
10 ug
£179,00
100-402-10UG
50 ug
£307,00
100-402-50UG
Über dieses Produkt
- SKU:
- 100-402
- Zusätzliche Namen:
- ANGPTL-3, ANG-5, ANGPT5
- Weitere Details:
- ANGPTL-3 (Angiopoietin like protein 3) is a member of the angiopoietin family of structurally related proteins, characterized by a coiled N-terminal domain and a C-terminal fibrinogen like domain. It is primarily expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism. ANGPTL-3 inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), which has the effect of increasing plasma levels of triglycerides and HDL associated cholesterol. The fibrinogen like portion of the ANGPTL-3 protein can bind alpha-5/beta-3 integrins leading to endothelial cell adhesion and migration. Recombinant human ANGPTL-3 is a glycoprotein that migrates by SDS-PAGE analysis at an apparent molecular weight of 62 kDa, and contains 452 amino acid residues including a C-terminal His tag.
- Formulierung:
- lyophilized
- Host:
- Mouse
- Molekulargewicht:
- 62 kDa
- Reinheit:
- > 97% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Human
- Sequenz:
- SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins