PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B, APRIN, CG008, FLJ23236, KIAA0979, RP1-267P19.1)
Produktgrößen
100ug
£659,00
P3126-25-100UG
Über dieses Produkt
- SKU:
- P3126-25
- Anwendung:
- Western Blot
- translate.label.attr.clone:
- 8C261
- Klonalität:
- Monoclonal
- Weitere Details:
- APRIN plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Applications: Suitable for use in Dot Blot and Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilution to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile glycerol (40-50), aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to human PDS5, Regulator of Cohesion Maintenance, Homolog B consisting of amino acids from the C-terminal portion of the protein (Sequence: QWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSP)
- Isotyp:
- IgG1
- Physischer Zustand:
- Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
- Reinheit:
- Purified by Protein G affinity chromatography from hybridoma culture supernatant
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human PDS5, Regulator of Cohesion Maintenance, Homolog B.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Monoclonal Antibody