LTBP2 (Latent-transforming Growth Factor beta-binding Protein 2, LTBP-2, C14orf141, LTBP3)
Produktgrößen
100ug
£685,00
L4715-02-100UG
Über dieses Produkt
- SKU:
- L4715-02
- Anwendung:
- Western Blot
- translate.label.attr.clone:
- 5D7
- Klonalität:
- Monoclonal
- Weitere Details:
- The protein encoded by this gene belongs to the family of latent transforming growth factor (TGF)-beta binding proteins (LTBP), which are extracellular matrix proteins with multi-domain structure. This protein is the largest member of the LTBP family possessing unique regions and with most similarity to the fibrillins. It has thus been suggested that it may have multiple functions: as a member of the TGF-beta latent complex, as a structural component of microfibrils, and a role in cell adhesion. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1709-1818 from human LTBP2 with GST tag. MW of the GST tag alone is 26kD. Species Sequence Homology: rat.
- Isotyp:
- IgG2a,k
- Physischer Zustand:
- Supplied as a liquid in PBS, pH 7.4.
- Reinheit:
- Purified.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human LTBP2.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Monoclonal Antibody