LRRK1 (Leucine-rich Repeat Serine/threonine-protein Kinase 1, Leucine-rich Repeat Kinase 1)
Produktgrößen
100ul
£614,00
485110-100UL
Über dieses Produkt
- SKU:
- 485110
- Anwendung:
- Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- The function of this protein remains unknown. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: ALMFLRLQGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAF corresponding to human LRRK1. Species Sequence Homology: bovine, canine, guinea pig, equine, mouse, porcine, rabbit and rat.
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human LRRK1.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody