Selenoprotein M, Recombinant, Human, aa24-145 (SELM)
Produktgrößen
20ug
£576,00
406037-20UG
Über dieses Produkt
- SKU:
- 406037
- Weitere Details:
- May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. Recombinant protein corresponding to aa24-145 from human Selenoprotein M, expressed in E. coli. Molecular Weight: ~13.9kD Amino Acid Sequence: ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Molekulargewicht:
- 13.9
- Physischer Zustand:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Reinheit:
- ≥90% (SDS-PAGE)
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules