OPA1 (Pptic Atrophy 1 (Autosomal Dominant), FLJ12460, KIAA0567, MGM1, NPG, NTG, LargeG) (FITC)
Produktgrößen
100ul
£914,00
249604-FITC-100UL
Über dieses Produkt
- SKU:
- 249604-FITC
- Anwendung:
- Western Blot, FLISA
- translate.label.attr.clone:
- 8A20
- Klonalität:
- Monoclonal
- Weitere Details:
- This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa851-890 from human OPA1 with GST tag. MW of the GST tag alone is 26kD.
- Isotyp:
- IgG2a,k
- Physischer Zustand:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Reinheit:
- Purified
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human OPA1.Species Crossreactivity: rat
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Monoclonal Antibody