MMRN1 (Multimerin 1, ECM, EMILIN4, GPIa*, MMRN) (MaxLight 490)
Produktgrößen
100ul
£914,00
248825-ML490-100UL
Über dieses Produkt
- SKU:
- 248825-ML490
- Anwendung:
- Western Blot, FLISA
- translate.label.attr.clone:
- 1G10
- Klonalität:
- Monoclonal
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. [provided by RefSeq Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa291-390 from human MMRN1 with GST tag. MW of the GST tag alone is 26kD.
- Isotyp:
- IgG2a,k
- Physischer Zustand:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with MaxLight™490.
- Reinheit:
- Purified
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human MMRN1.
- Quelle:
- human
- Lagerbedingungen:
- 4[o]C Do Not Freeze
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Monoclonal Antibody