SLC16A1 (Monocarboxylate Transporter 1, MCT 1, Solute Carrier Family 16 Member 1, MCT1, FLJ36745, MGC44475)
Produktgrößen
100ul
£744,00
138346-100UL
Über dieses Produkt
- SKU:
- 138346
- Anwendung:
- Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the action of a proton-coupled MCT. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human SLC16A1.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody