FICD (Adenosine Monophosphate-protein Transferase FICD, AMPylator FICD, FIC Domain-containing Protein, Huntingtin Yeast Partner E, Huntingtin-interacting Protein 13, HIP-13, Huntingtin-interacting Protein E, HIP13, HYPE, UNQ3041/PRO9857)
Produktgrößen
100ul
£744,00
137975-100UL
Über dieses Produkt
- SKU:
- 137975
- Anwendung:
- Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- C-terminus of FICD corresponding to FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes FICD. Species Crossreactivity: Human, mouse, rat and canine.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody