FGA (Fibrinogen alpha Chain, Fib2, MGC119422, MGC119423, MGC119425)
Produktgrößen
100ul
£744,00
137961-100UL
Über dieses Produkt
- SKU:
- 137961
- Anwendung:
- Western Blot, Immunohistochemistry
- Klonalität:
- Polyclonal
- Weitere Details:
- FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- N-terminus of FGA corresponding to MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human fibrinogen Alpha.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody